Tuesday, August 31, 2021

Discount 90% Offer 10w Rgbw Led Video Lighting Handheld Photography Light Ice Light For Studio Photo Videography With 12 Level Brightness 8 Colors with FREE Shipping Worldwide Now!

US $68.40 10w Rgbw Led Video Lighting Handheld Photography Light Ice Light For Studio Photo Videography With 12 Level Brightness 8 Colors
US $68.40 Original Price : US $US $85.50 (-20%)  

Free Shipping Price 10w Rgbw Led Video Lighting Handheld Photography Light Ice Light For Studio Photo Videography With 12 Level Brightness 8 Colors with FREE Shipping Worldwide!

US $68.40 10w Rgbw Led Video Lighting Handheld Photography Light Ice Light For Studio Photo Videography With 12 Level Brightness 8 Colors
US $68.40 10w Rgbw Led Video Lighting Handheld Photography Light Ice Light For Studio Photo Videography With 12 Level Brightness 8 Colors
 4.8


Related Products :


Discount 90% Price Vintage Round Optical Eyeglasses Frames Thom Brand Designer Tb011 Myopia Anti Blue Prescription Glasses Men Women With Case with Free Worldwide Shipping Now!

Limited Price Hiseeu 8ch Cctv Camera System Wireless 6pcs 1080p Wifi Ip Camera Outdoor Home Security Video Surveillance System Nvr Kit with Free Worldwide Shipping Now!

Best Offer Pgst Gsm Wifi Security Alarm 433mhz Motion Detector App Control Home Burglar Unclosed Door Reminder Alarm System For Home with FREE Worldwide Shipping Now!

Free Shipping Offer Astrolux Mf01s 18x Sst20 15000lm 616m Detector Anduril Ui 18650 Flashlight High Cri Bright Searching Flashlight Hunting Torch with FREE Worldwide Shipping Now!

Discount 90% Offer New Mens Leather Golf Belt Descent Metal Buckle Sports Leisure Belt Golf Accessories120cm Length Can Be Cut Free Shipping with Free Worldwide Shipping Now!

Discount Price Smart Door Lock S3 Home Keyless Electronic Door Lock with 2PCS Keys Bluetooth Wireless APP mobilephone Control SherlockSilver with FREE Shipping Worldwide Now!

Discount Price Carburetor Carb For Chinese Chainsaw 4500 5200 5800 45cc 52cc 58cc Fuel Oil Filter Line Gasket Bolt Adaptor Bracket Kit with Free Worldwide Shipping Now!

Discount 90% Offer TACSKY COMTAC III New Detachable Headband Silicone Earcups Noise Hunting Sports Military Tactical Headset Peltor Comtac III CB with Free Shipping Worldwide Now!

Limited Price 27pcs Silk Scarf Women 2020 New 9090cm Imitation Silk Small Square Scarf Leaf Print Shawl with Free Worldwide Shipping Now!

Discount Offer SFHC25G SFHC25K thc plasma cnc cutting machine automatic Arc cap voltage Plasma cutting machine cutter torch height controller with FREE Worldwide Shipping Now!

Free Shipping Price 10w Rgbw Led Video Lighting Handheld Photography Light Ice Light For Studio Photo Videography With 12 Level Brightness 8 Colors with FREE Shipping Worldwide!


Brand Name: YOUKOYI
Origin: CN(Origin)
Color Temperature: Nature White(3500-5500K)
Model Number: Photography light
LED Chip Model: SMD5050
Occasion: living room
Voltage: 5V 2A
Luminous Flux: 500 - 999 Lumens
Shape: Bar
Average Life (hrs): 50000 hours
Length: 0.6m
Item Type: LED Bulbs
Led Bulb Type: Tube
LED Chip Brand: Edison
Certification: CCC
Certification: ROHS
Beam Angle(°): 30°
Base Type: 2G7
Power Tolerance: 5%


At this time of writing, the Original 10w Rgbw Led Video Lighting Handheld Photography Light Ice Light For Studio Photo Videography With 12 Level Brightness 8 Colors has garnered 3 customer reviews with rating of 5 out of 5 stars. Not a bad score at all as if you round it off, it’s actually a perfect five already. From the looks of that rating, we can say the product is promising


Free Shipping Price - 10w Rgbw Led Video Lighting Handheld Photography Light Ice Light For Studio Photo Videography With 12 Level Brightness 8 Colors with FREE Shipping Worldwide NOW!



Related Products :


Discount 80% Offer 2020 New Design Mermaid Wedding Dress Sleevelesss Vestidos De Novia Vintage Lace Sweetheart Bridal Gown Backless Wedding Gowns with FREE Shipping Worldwide Now!

Discount 90% Offer Human Face Record H265 8CH POE NVR Kit 5MP POE Outdoor Camera CCTV Camera System Home Security Video Surveillance Set with Free Shipping Worldwide Now!

Special Offer Italian Led Iron Wall Lamps Modern Living Room Bedroom Wall Light Branch Glass Bedside Lighting Home Decor Wall Sconce Luminaria with FREE Shipping Worldwide Now!

Cheap Price Real Fox Raccoon Fur Hang Ear Cover Warm Winter Earmuffs Headwear Ear Muffs Earmuffs Cold Ear Warmer Ear Protection Headband with Free Worldwide Shipping Now!

Best Price Soolala High End Prescription Myopia Glasses Frame Eyeglasses Women Optical Lens Nearsighted With Diopter Eyewear 10 To 40 with Free Shipping Worldwide Now!

Popular Offer Original Dahua IPCHDW2431TMASS2 IP Camera HD 4MP PoE IR30M Micro SD Card Slot H265 IP67 IK10 Dome Camara Webcam Builtin Mic with Free Worldwide Shipping Now!

Limited Offer Mens Real Leather Vegetable Tanned Leather Winter Warm Tan Wrist Button Driving Short Gloves with Free Worldwide Shipping Now!

Limited Offer Livolo Us Standard Crystal Glass Panel Curtain Wireless Remote Control Blind Control With Remote Function with FREE Shipping Worldwide Now!

Discount 90% Offer 3pcs 12mm Shank Rail Stile Ogee Blade Cutter Panel Raised Cabinet Router Bit Set Door Tenon Woodworking Tools with FREE Worldwide Shipping Now!

Cheap Offer Free Shipping Winter Women Real Leather Letters Maple Leaf Baseball Caps Men Ladies Casual Hip Hop Hat Man Street Hockey Gorra with Free Shipping Worldwide Now!


Limited Offer Retro Lighting Control Switches 16a Vintage Light Switch Ccc Attest Bronze Wall Switch Panel Warranty 5 Year Power Button Switch with FREE Shipping Worldwide Now!

US $25.55 Retro Lighting Control Switches 16a Vintage Light Switch Ccc Attest Bronze Wall Switch Panel Warranty 5 Year Power Button Switch
US $25.55 Original Price : US $US $28.39 (-10%)  

Discount 80% Price Retro Lighting Control Switches 16a Vintage Light Switch Ccc Attest Bronze Wall Switch Panel Warranty 5 Year Power Button Switch with FREE Worldwide Shipping!

US $25.55 Retro Lighting Control Switches 16a Vintage Light Switch Ccc Attest Bronze Wall Switch Panel Warranty 5 Year Power Button Switch
US $25.55 Retro Lighting Control Switches 16a Vintage Light Switch Ccc Attest Bronze Wall Switch Panel Warranty 5 Year Power Button Switch
 4.4


Related Products :


Discount Price Ignition Coil Module For Stihl Ms270 Ms280 Ms 270 280 Chainsaw Replacement Parts 1133 400 1350 11334001350 with Free Shipping Worldwide Now!

Free Shipping Offer 8pcs No1No8 M04 M05 M06 M07 M08 M1 M125 M15 M2 M3 M4 Modulus Pa20 Degrees Hss Gear Milling Cutter Gear Cutting Tools with FREE Worldwide Shipping Now!

Special Offer Iface Matrix Tester Face Id Dot Projector Work Or Not Test For Iphone X Xr Xs Xsmax 11 Pro Max Ipad A12 Face Lattice Maintenance with FREE Worldwide Shipping Now!

Special Price Xcan 7pcs Hss Counterbore End Mill M32M124 Pilot Slotting Tool Milling Cutter Countersink End Mills with Free Worldwide Shipping Now!

Discount 80% Offer Global Version Mijia IMILAB IP Camera Mi Home App 016 WiFi Security Camera CCTV Baby Monitor HD 1080P Surveillance H265 with FREE Worldwide Shipping Now!

Best Offer 50w NJk Rf Coaxial Fixed Attenuator Dc3ghz50 Ohm1db2db3db5db6db10db15db20db30db40db50dbfree Shopping with Free Shipping Worldwide Now!

Discount 90% Price Mzg P3202D10R5 D16R8 Zp35 Carbide Inserts Steel Processing Fast Feeding Cutting Milling Cutter Machining with FREE Shipping Worldwide Now!

Limited Price 5MP Wireless 5X Zoom MINI PTZ IP WIFI Camera Speed Dome CCTV Video Security Cam ONVIF Outdoor IR 30M Two Way Audio P2P CamHi with Free Worldwide Shipping Now!

Best Offer Modern Led Smart Ceiling Light 36w 45w Wifi Tuya App Google Home Alexa Echo Ai Voice Control Surface Mounting Ceiling Lamp with Free Worldwide Shipping Now!

Discount Price 100 Real Fox Fur Collar Winter Woman Natural Fluffy Fur Gray Collar Real Fur Shawl Raccoon Collar Fur Scarf Women Luxury with Free Shipping Worldwide Now!

Discount 80% Price Retro Lighting Control Switches 16a Vintage Light Switch Ccc Attest Bronze Wall Switch Panel Warranty 5 Year Power Button Switch with FREE Worldwide Shipping!


Brand Name: KAMANNI
Origin: CN(Origin)
Certification: CCC
Current: 10A
Features: bronze
Material: Copper
Item Type: Switches
Warranty: 5 year
Model Number: switch
Switch Type: Push Button Switch
Features: Vintage light switch
features 1: switches
features 2: momentary
features 3: new
features 4: on-off-on
certification: ccc
item type: switches
switch type: push button switch
warranty: 1 year
material: copper
size: 86mm*86mm*36mm
Applicable box: diameter 66mm


At this time of writing, the Original Retro Lighting Control Switches 16a Vintage Light Switch Ccc Attest Bronze Wall Switch Panel Warranty 5 Year Power Button Switch has garnered 1 customer reviews with rating of 5 out of 5 stars. Not a bad score at all as if you round it off, it’s actually a perfect five already. From the looks of that rating, we can say the product is promising


Discount 80% Price - Retro Lighting Control Switches 16a Vintage Light Switch Ccc Attest Bronze Wall Switch Panel Warranty 5 Year Power Button Switch with FREE Worldwide Shipping NOW!



Related Products :


Best Offer Automatic Door Lock Ip65 Weatherproof Key Card Lock 6v Working Voltage Card Access Door Lock Long Battery Life For Outdoor with Free Worldwide Shipping Now!

Discount 80% Price 202 Pcs Deutsch Dtm Waterproof Wire Connector Kit Dtm062346812s Dtm042346812p Automotive Sealed Plug With Pins with Free Shipping Worldwide Now!

Cheap Offer Anpviz 2MP5MP IP POE PTZ Camera Dome 4X Zoom Outdoor Security IP Camera TwoWay Audio Builtin Mic and Speaker 30m Onvif IP66 with Free Shipping Worldwide Now!

Discount 90% Price Lace Up Corset Wedding Dresses Bridal Ball Gowns Long Sleeves Bride Bridal Gown Dresses Appliques Custom with FREE Shipping Worldwide Now!

Best Offer Fonex Acetate Alloy Glasses Frame Men Women Vintage Square Myopia Optical Frames Prescription Eyeglasses Screwless Eyewear 98628 with FREE Shipping Worldwide Now!

Free Shipping Price Reolink Go With Solar Panel Battery 4g Sim Card Network Camera Starlight Vision Wild Video Surveillance Ip Cam with FREE Worldwide Shipping Now!

Free Shipping Price JC Pro1000S JC P11 P7 pro NAND Programmer Read Write Repair Tool Battery Data Cable Headphone Tester For iPhone 11 6 7 8 X XR XS with FREE Shipping Worldwide Now!

Limited Offer 110pcs Matric Thread Tap And Die Set Hss Plug Tap Die Wrench Set Hand Tapping Tools Metal Screw Hole Tap Drill Set with Free Worldwide Shipping Now!

Discount Offer Cook Shark Mens Sunglasses Polarized Glasses Hipster Driver Driving Glasses Eyes 2020 New Sunglasses with FREE Shipping Worldwide Now!

Best Price Hikvision Nvr 4ch 4k 8mp Poe Ds7604niK14p For Ip Camera Cctv Security System Vca Detection Upgradeable PlugAmpPlay Onvif with Free Shipping Worldwide Now!


Discount 90% Price Led Landscapes Light Outdoor Waterproof Decoration Yard Pathway Villa Garden Bollards Led Lawn Lamps H30cm 10w Ac85265v with FREE Shipping Worldwide Now!

US $37.77 Led Landscapes Light Outdoor Waterproof Decoration Yard Pathway Villa Garden Bollards Led Lawn Lamps H30cm 10w Ac85265v
US $37.77 Original Price : US $US $85.83 (-56%)  

Special Offer Led Landscapes Light Outdoor Waterproof Decoration Yard Pathway Villa Garden Bollards Led Lawn Lamps H30cm 10w Ac85265v with FREE Worldwide Shipping!

US $37.77 Led Landscapes Light Outdoor Waterproof Decoration Yard Pathway Villa Garden Bollards Led Lawn Lamps H30cm 10w Ac85265v
US $37.77 Led Landscapes Light Outdoor Waterproof Decoration Yard Pathway Villa Garden Bollards Led Lawn Lamps H30cm 10w Ac85265v
 5


Related Products :


Discount 70% Price Mens spring and summer light breathable safety work shoes steel toe safety boots SSOP protective indestructible shoes with Free Worldwide Shipping Now!

Discount 80% Price 202 Pcs Deutsch Dtm Waterproof Wire Connector Kit Dtm062346812s Dtm042346812p Automotive Sealed Plug With Pins with Free Shipping Worldwide Now!

Discount 70% Price Cheap Illusion Vestido De Noiva ONeck Ball Gown Princess Wedding Dress 2021 Appliques Luxury Bride Sexy Back Robe De Mariee with Free Shipping Worldwide Now!

Discount 70% Price Hikvision POE NVR DS7616NII216P 16CH H265 12mp POE NVR for IP Camera Support Two way Audio HIKCONNECT with Free Shipping Worldwide Now!

Discount Offer 36pcs 40mm Magnetic Screwdriver Bits For Dc Powered Electric Screwdriver Magnetic Hex Shank Cross Head One Head Hex Head Set with Free Worldwide Shipping Now!

Special Price dahua nvr kit security camera system 16 ch NVR 4K recorder 16ch NVR4116HS4KS2 Network Switch DomeCamera IPCHDW1325C 3MP 16PCS with FREE Worldwide Shipping Now!

Special Offer Led Ceiling Light Dimmable 36w 45w 220v With Preset 3000k 4000k 5000k For Bedroom Livingroom Bathroom Modern Ceiling Lamp with Free Shipping Worldwide Now!

Discount 80% Price Guyx Heat Press Machine Leather Embossing Foil Gold Stamping Hot Pressing Mold Cutting Rhombus Punching Branding Wood with FREE Worldwide Shipping Now!

Discount 80% Price Soft Dent Removal Heat Induction System Induction Machine Electromagnetic Induction Machine And Led Light For Dent with FREE Worldwide Shipping Now!

Discount 90% Offer H265 Starlight Outdoor AudioIn Bullet Wireless Cctv Network Ip Camera Max Support 128gb Tf Card Slot Onvif Rtsp Metal House with FREE Worldwide Shipping Now!

Special Offer Led Landscapes Light Outdoor Waterproof Decoration Yard Pathway Villa Garden Bollards Led Lawn Lamps H30cm 10w Ac85265v with FREE Worldwide Shipping!


Brand Name: wecus
Certification: CCC
Is Bulbs Included: Yes
Origin: CN(Origin)
Model Number: NEW-2017-10
Protection Level: IP65
Body Material: Aluminum
Voltage: 85-265V
Features: High-end lawn lamp
Light Source: LED Bulbs
Power Source: AC
Style: Modern
Item Type: Lawn Lamps
Warranty: 3 years
Usage: Industrial
Is Dimmable: No
Base Type: Wedge


At this time of writing, the Original Led Landscapes Light Outdoor Waterproof Decoration Yard Pathway Villa Garden Bollards Led Lawn Lamps H30cm 10w Ac85265v has garnered 3 customer reviews with rating of 5 out of 5 stars. Not a bad score at all as if you round it off, it’s actually a perfect five already. From the looks of that rating, we can say the product is promising


Special Offer - Led Landscapes Light Outdoor Waterproof Decoration Yard Pathway Villa Garden Bollards Led Lawn Lamps H30cm 10w Ac85265v with FREE Worldwide Shipping NOW!



Related Products :


Discount 80% Price Acetate Polarized Sunglasses Women Brand Designer Cat Eye Luxury Sexy Cateye Pearl Oversize Mirror Korean Sun Glasses For Woman with FREE Worldwide Shipping Now!

Discount Offer Running shoes Mens sports shoes Breathable fitness sports shoes Womens gym sports shoes Outdoor sports shoes Unisex breathable with FREE Shipping Worldwide Now!

Discount 90% Offer MISECU Ai Smart 5MP System 16CH POE CCTV Security NVR Kit HumanFace Detect Two Way Audio Outdoor IP Camera Surveillance System with Free Shipping Worldwide Now!

Limited Offer Engine Camshaft Timing Locking Tool Set For Mercedes Benz M133 M270 M74 SK1320 with Free Shipping Worldwide Now!

Cheap Offer Nordic Modern Loft Pendant Lamp 7 Color Glass Lustre Industrial Decor Hanging Lights Fixtures E27E26 For Kitchen Restaurant with FREE Shipping Worldwide Now!

Best Offer Fajarina Top Quality MenS Retro Cowhide Leather Belts Solid Pure Cow Skin Brass Pin Buckle Metal Belt For Men 38cm N17fj886 with FREE Worldwide Shipping Now!

Discount Price Mars Hydro Ts 1000w Led Grow Light 70x70x160cm Grow Tent Full Spectrum Indoor Plants Garden Hydroponics Plant Growing Light with FREE Worldwide Shipping Now!

Discount 80% Offer Hikvision OEM NVR Anpviz 4K 8MP 16CH H265 Network Video Recorder 16 POE HikConnect Network Management Up to 6TB 2 SATA Onvif with FREE Shipping Worldwide Now!

Best Offer HeimVision CA01 1080P 20MP Bullet Surveillance Camera Supply for HeimVision HM241HM243 8CH Security Camera System Waterproof with FREE Worldwide Shipping Now!

Cheap Offer Allsome Miniq Mini Drilling Press 220v 680w Electric Milling Machine Variable Speed Drill Machine Grinder For Diy Power Tools Bg with FREE Shipping Worldwide Now!


Discount 80% Price Sofirn New Sp32a V20 High Power Led Flashlight 18650 Cree Xpl2 1300lm Torch Light 2 Groups By Dtp Pcb Indicator Light Pale Gold with Free Worldwide Shipping Now!

US $21.99 Sofirn New Sp32a V20 High Power Led Flashlight 18650 Cree Xpl2 1300lm Torch Light 2 Groups By Dtp Pcb Indicator Light Pale Gold
US $21.99 Original Price : US $US $27.49 (-20%)  

Best Offer Sofirn New Sp32a V20 High Power Led Flashlight 18650 Cree Xpl2 1300lm Torch Light 2 Groups By Dtp Pcb Indicator Light Pale Gold with Free Shipping Worldwide!

US $21.99 Sofirn New Sp32a V20 High Power Led Flashlight 18650 Cree Xpl2 1300lm Torch Light 2 Groups By Dtp Pcb Indicator Light Pale Gold
US $21.99 Sofirn New Sp32a V20 High Power Led Flashlight 18650 Cree Xpl2 1300lm Torch Light 2 Groups By Dtp Pcb Indicator Light Pale Gold
 4.5


Related Products :


Discount 90% Offer Modern Ring Glass Ball Led Chandelier Nordic Style Living Dining Room Kitchen Study Gloss Home Design Interior Decoration Lamps with Free Shipping Worldwide Now!

Discount 90% Offer Traugel Scoop A Line Lace Wedding Dresses Elegant Applique Long Sleeve Button Bride Dress Cathedral Train Bridal Gown Plus Size with FREE Shipping Worldwide Now!

Special Price OwlCat 5x 10x Optical Zoom HD 5MP Sony 335 PTZ WiFi IP Camera Wireless Bullet Outdoor with TF SD Card 128GB Video Audio Mic IR with Free Worldwide Shipping Now!

Discount Offer 3000w New Double Switch Led Plant Growth Light Full Spectrum Plant Light Used For Indoor Plants Vegetables Flowering Phyto Lamp with Free Worldwide Shipping Now!

Discount Offer Running shoes Mens sports shoes Breathable fitness sports shoes Womens gym sports shoes Outdoor sports shoes Unisex breathable with FREE Shipping Worldwide Now!

Cheap Offer Kerui W18 Wireless WIFI GSM IOS Android APP Control Home Security Burglar Alarm System Smart Water Leak Detector with FREE Worldwide Shipping Now!

Discount 70% Offer CCTV Security AHD 5MP MINI Speed Dome PTZ Camera 4x Zoom 2812mm 4 LED IR 30M AHD TVI CVI HD Cameras with FREE Worldwide Shipping Now!

Discount 70% Offer Nordic Design Chandelier Long Glass Ball Led Living Dining Room Kitchen Bar Ceiling Home Decoration Interior Lighting Black Lamp with FREE Worldwide Shipping Now!

Discount 70% Price New Arrival Mini Led 9x10w Led Spider Light Rgbw 1648ch Dmx Stage Lights Dj Led Spider Moving Head Beam Light with FREE Shipping Worldwide Now!

Popular Price MISECU 4CH 8CH 1080P POE NVR Kit Security Camera H265CCTV System Indoor Audio Record IP Dome Camera P2P Video Surveillance Set with Free Worldwide Shipping Now!

Best Offer Sofirn New Sp32a V20 High Power Led Flashlight 18650 Cree Xpl2 1300lm Torch Light 2 Groups By Dtp Pcb Indicator Light Pale Gold with Free Shipping Worldwide!


Brand Name: Sofirn
Origin: CN(Origin)
Function: Shock Resistant
Function: Hard Light
Focal Length: Non-adjustable
Model Number: SP32A V2.0
Zoom: No
Lighting Distance: 200m
Support Dimmer: Stepless dimming
Wattage: 10
Flashlight Type: outdoor light campingcyclinghikingfishingect
Color: MULTI
Waterproof: Yes
Lumen: 1300
Certification: CCC
Certification: ROHS
Certification: ce
Certification: FCC
Switch Mode: High/Middle/Low
Body Material: Aluminum Alloy
Model of LED Beads: Cree XP-L2
Charger: Not Applicable
Item Type: Flashlights
Light Source: LED emitter
Color: Black Brown silver
PCB: Copper DTP MCPCB
Features: Over heat protection
Featires: Low voltage protection
Groups: 2 Groups with Raming and 6 modes


At this time of writing, the Original Sofirn New Sp32a V20 High Power Led Flashlight 18650 Cree Xpl2 1300lm Torch Light 2 Groups By Dtp Pcb Indicator Light Pale Gold has garnered 2 customer reviews with rating of 5 out of 5 stars. Not a bad score at all as if you round it off, it’s actually a perfect five already. From the looks of that rating, we can say the product is promising


Best Offer - Sofirn New Sp32a V20 High Power Led Flashlight 18650 Cree Xpl2 1300lm Torch Light 2 Groups By Dtp Pcb Indicator Light Pale Gold with Free Shipping Worldwide NOW!



Related Products :


Special Offer Twosun Ts21 Flipper Folding Knife Titanium Handle 343 D2 Satin Blade Outdoor Hunting Pocket Edc Tools Free Shipping with FREE Worldwide Shipping Now!

Discount 80% Offer Modern Led Pendant Lights For Living Room Dining Room Bedroom Hanging Lighting Fixtures Home Indoor Led Pendant Lamp Ac110v 220v with FREE Shipping Worldwide Now!

Special Offer Girls Winter Warm Beret Hats Female British Woolen Cap Adult Recreational Ancient Painter Hats Butterfly Knot Caps Adjust A103 with FREE Shipping Worldwide Now!

Discount 90% Price Smar 24 inch Audio Video Wireless Baby Monitor Security Camera Baby Nanny Music Intercom Night Vision Temperature Monitoring with Free Worldwide Shipping Now!

Best Price Weldy Professional 1600W Digital Hot Blast Torch Overlap Air Welding Gun Welder Pistol Tool Hot Air Gun PVC welding tool kit with Free Shipping Worldwide Now!

Best Price Caponi Finished Myopia Sunglasses Men Custom Prescription Avation Eyewear Pilot Polarized Nearsight Men Sun Glasses Js3109 with Free Shipping Worldwide Now!

Free Shipping Price Hikvision Darkfighter Original Ds2cd2085g1I 8mp 20fps Bullet Network Cctv Ip Camera H265 Poe Wdr Sd Card Slot with FREE Worldwide Shipping Now!

Cheap Price 156 160 167 174 Add 050350 Progressive Multifocal Lenses Prescription Myopia Hyperopia Resistance Short Middle Far Lens with Free Shipping Worldwide Now!

Discount 80% Price 1 Piece Din69871 Sk40Er32 Sk40 Er25 Sk40 Er20 Sk40 Er16 High Precision Tool Holder Spring Milling Tool Holder with FREE Worldwide Shipping Now!

Discount 90% Offer 2020 New 2 In 1 Bluetooth Speaker Bulb 24w E27 Rgbw Led Dimmable Smart Light Bulb App Ir Remote Control 85265v For Home with Free Worldwide Shipping Now!


Free Shipping Price 100 New 1set 12pcs Led Strip For 50 Tv Lc50lb371c Lc50lb481c Yx50018014 Tt5004c Tt5008t 50pft5300 500tt64 50put6400 with Free Worldwide Shipping Now!

US $20.70 100 New 1set 12pcs Led Strip For 50 Tv Lc50lb371c Lc50lb481c Yx50018014 Tt5004c Tt5008t 50pft5300 500tt64 50put6400
US $20.70 Original Price : US $US $23.00 (-10%)  

Discount 90% Offer 100 New 1set 12pcs Led Strip For 50 Tv Lc50lb371c Lc50lb481c Yx50018014 Tt5004c Tt5008t 50pft5300 500tt64 50put6400 with Free Shipping Worldwide!

US $20.70 100 New 1set 12pcs Led Strip For 50 Tv Lc50lb371c Lc50lb481c Yx50018014 Tt5004c Tt5008t 50pft5300 500tt64 50put6400
US $20.70 100 New 1set 12pcs Led Strip For 50 Tv Lc50lb371c Lc50lb481c Yx50018014 Tt5004c Tt5008t 50pft5300 500tt64 50put6400
 4.2


Related Products :


Limited Price Metal Pipe Living Room Led Wall Light GoldBlack Body Bedroom Lamp Corridor Wall Sconce Loft Home Deco 90260v Nordic Luminaire with FREE Shipping Worldwide Now!

Best Offer Electric Rechargeable 14 Inch 635mm Cordless Brushless Impact Driver Drill With One 18v 40ah Lithium Battery with Free Worldwide Shipping Now!

Best Offer Jmmxiuz Modern Large Big Stair Long Spiral Crystal Chandelier Lighting Fixture For Staircase Rain Drop Pending Lamp Free Ship with FREE Worldwide Shipping Now!

Special Price Modern Led Living Room Standing Lamp Bedside Lights Home Deco Lighting Glass Ball Fixtures Nordic Bedroom Floor Lamps with Free Worldwide Shipping Now!

Free Shipping Price Led Modern Iron Acryl Colorized Round 5cm Super Thin Led LampLed LightCeiling LightsLed Ceiling LightCeiling Lamp For Foyer with FREE Shipping Worldwide Now!

Popular Price Zohan Electronic Earmuff Nrr22db Ear Cup For Single Microphone Hunting Earmuffs Tactical Shooting Hearing Protection Replacement with FREE Shipping Worldwide Now!

Best Offer Dahua Security Ip Camera Hdw4636cA 6mp BuiltIn Mic 4mp Dome Cctv Camera Hdw4438cA 2mp 1080hd Starlight Sensori Night Vision with Free Shipping Worldwide Now!

Discount 80% Price Mzg Asm 07 12 16 20 Mm Jdmt 0702 Carbide Inserts Clamped Alloy End Mills Small Arbor Milling Cutter Machining Shoulder Tools with Free Shipping Worldwide Now!

Discount 80% Offer Unilook 32ch Nvr Poe Hikvision Oem Ds7732niI416p Network Video Recoder Cctv System Max Support 12mp Resolution H265 P2p with FREE Shipping Worldwide Now!

Popular Offer KERUI 1080P Wifi IP Camera Outdoor Wireless Camera Twoway Audio P2P Audio 2MP Security CCTV Camera Infrared Night Vision with FREE Shipping Worldwide Now!

Discount 90% Offer 100 New 1set 12pcs Led Strip For 50 Tv Lc50lb371c Lc50lb481c Yx50018014 Tt5004c Tt5008t 50pft5300 500tt64 50put6400 with Free Shipping Worldwide!


Brand Name: BRIDAY
Usage: Industrial
Is Dimmable: No
Model Number: LC-50LB371C
Width: 1.7cm
Body Material: Aluminum
Light Source: LED Bulbs
Length: 100cm
Voltage: 85-265V
Wattage: 10w
Item Type: Bar Lights
Warranty: 4 months


At this time of writing, the Original 100 New 1set 12pcs Led Strip For 50 Tv Lc50lb371c Lc50lb481c Yx50018014 Tt5004c Tt5008t 50pft5300 500tt64 50put6400 has garnered 4 customer reviews with rating of 5 out of 5 stars. Not a bad score at all as if you round it off, it’s actually a perfect five already. From the looks of that rating, we can say the product is promising


Discount 90% Offer - 100 New 1set 12pcs Led Strip For 50 Tv Lc50lb371c Lc50lb481c Yx50018014 Tt5004c Tt5008t 50pft5300 500tt64 50put6400 with Free Shipping Worldwide NOW!



Related Products :


Discount Price 15cm Imitation Sinamay Fascinator Base Party Hats Diy Hair Accessories Cocktail Headwear Bridal Hats Wedding Millinery 16 Colors with FREE Worldwide Shipping Now!

Discount 70% Offer Wifi Gprs Gsm Alarm Safety System Smartlife Remote App Control With Smoke Detector Siren Wireless Smart Home Security Alarm Kit with FREE Shipping Worldwide Now!

Discount Offer Samkoon Ea043a Hmi Touch Screen 43 Inch And S7200 Series Plc Industrial Control Board Cpu222 Cpu224 Cpu226 Cpu224xp with Free Shipping Worldwide Now!

Discount 90% Price OEM 433MHz 4D63 Chip PN6C1T15K601AG 3 Button Remote Car Key Fob for Ford Transit WM VM With Black Blade FO21 with Free Worldwide Shipping Now!

Discount 70% Offer Jabe Ud1200 Solder Station LeadFree Intelligent Rework Station Fast Heating 110v220v Soldering Station Jabe Ud1200 with Free Shipping Worldwide Now!

Discount Offer Homefong Electronic Door Lock For Video Intercom Door Phone Wired Support Remote Unlock With Key Door Access Control System Kit with FREE Worldwide Shipping Now!

Popular Offer 100 Wool Scarf Women 2020 Winter Scarf Thicken Warm Scarves Winter Solid Color Wrap Pashmina Cashmere Wool Echarpe Femme Hiver with Free Worldwide Shipping Now!

Discount 80% Offer 100 Pure Silk Scarf Ladies 2020 New Real Hangzhou Silk Wraps For Women Print Shawls Vintage Scarves Silk Natural Foulard Femme with Free Worldwide Shipping Now!

Cheap Price Zosi 1080p Ptz Ip Camera Wifi Outdoor Speed Dome Wireless Wifi Security Camera Pan Tilt 4x Digital Zoom 2mp Cctv Surveillance with Free Shipping Worldwide Now!

Best Price Modern Led Ceiling Lamp Luster Black And White Led Ceiling Lamp For Livingroom Lights Hallway Balcony Lights Fixtures with Free Shipping Worldwide Now!


Best Offer Super Bright 240w 480w 720w Samsung Lm301b Lm301h Dimmable Led Board Uv Ir Led Grow Light Meanwell Driver 7 Years Warranty with Free Worldwide Shipping Now!

US $149.79 Super Bright 240w 480w 720w Samsung Lm301b Lm301h Dimmable Led Board Uv Ir Led Grow Light Meanwell Driver 7 Years Warranty
US $149.79 Original Price : US $US $213.99 (-30%)  

Discount 90% Price Super Bright 240w 480w 720w Samsung Lm301b Lm301h Dimmable Led Board Uv Ir Led Grow Light Meanwell Driver 7 Years Warranty with FREE Worldwide Shipping!

US $149.79 Super Bright 240w 480w 720w Samsung Lm301b Lm301h Dimmable Led Board Uv Ir Led Grow Light Meanwell Driver 7 Years Warranty
US $149.79 Super Bright 240w 480w 720w Samsung Lm301b Lm301h Dimmable Led Board Uv Ir Led Grow Light Meanwell Driver 7 Years Warranty
 4.1


Related Products :


Discount 80% Offer Black White Color Modern Pendant Lights For Living Room Dining Room 321 Circle Rings Led Lighting Ceiling Lamp Fixtures with FREE Shipping Worldwide Now!

Limited Offer 39mm Cylinder Piston Carburetor Gasket Engine Kit For Husqvarna 236 240 235 236e 240e Chainsaw Motor Replacement Parts 545050417 with FREE Shipping Worldwide Now!

Special Offer New TS80P Mini Smart Portable Digital Soldering Iron Tool Adjustable Temperature OLED Display With B02 Iron Tips QC30 PD20 45W with Free Worldwide Shipping Now!

Limited Offer Lavie 2pcs 12mm 12 Shank Entry Interior Door Ogee Router Bit Matched Milling Cutter Set For Wood Woodworking Machine 03123 with Free Shipping Worldwide Now!

Discount Price Mc900 Analogue Drone Camera Weight 1g 00008luxF12 520tvl Small Size Serutiy Camera 36v5v Mini Cctv Camera For Aeromodell with Free Worldwide Shipping Now!

Discount Offer Yobang Security 7 24G Wireless CCTV System Camera Security Video Surveillance IR Night light Video Recording Camera DVR System with FREE Shipping Worldwide Now!

Discount 90% Offer H265 20mp Poe Ip Camera Ip66 Waterproof Night Vision Audio Record Cctv Security Camera System Video Surveillance For Poe Nvr with Free Shipping Worldwide Now!

Discount Offer Led Pendant Lamp Dimmable Hanging Lights Kitchen Island Dining Room Shop Bar Counter Decoration Cylinder Pipe Kitchen Lights with FREE Worldwide Shipping Now!

Popular Price Bside Digital Multimeter Profesional True Rms 8000 Analogue Tester 20a Current Dc Ac Voltage Capacitance Vfc Ohm Battery Hz Test with Free Worldwide Shipping Now!

Limited Price Bobo Bird Ebony Wooden Male Lady Sunglasses Mens Luxury Brand Designer Polarized Sun Glasses Vintage Sunglass Women Eyewear with Free Shipping Worldwide Now!

Discount 90% Price Super Bright 240w 480w 720w Samsung Lm301b Lm301h Dimmable Led Board Uv Ir Led Grow Light Meanwell Driver 7 Years Warranty with FREE Worldwide Shipping!


Brand Name: YXO YUXINOU
Is Dimmable: Yes
Certification: ce
Certification: ROHS
Material: Aluminum
Model Number: FLL-Growss240W
Width: 10
Body Material: Aluminum
Features: round
Light Source: LED Bulbs
Voltage: 85-265V
Warranty: 3 Years
Length: 50cm
Power Source: AC
Voltage: 85-277V
Driver: Meanwell driver
Chip: LM301B/LM301H
Wattage: 240w/480w/720w
Flux Lm: 48000LM
LED Factory: Samsung
Color: 3000K/3000K+660NM
LED Spectrum: Really full Spectrum 380nm~780nm
Features: Sansung LM301B COB led grow light full spectrum
Item Type: LED Grow Lights


At this time of writing, the Original Super Bright 240w 480w 720w Samsung Lm301b Lm301h Dimmable Led Board Uv Ir Led Grow Light Meanwell Driver 7 Years Warranty has garnered 5 customer reviews with rating of 5 out of 5 stars. Not a bad score at all as if you round it off, it’s actually a perfect five already. From the looks of that rating, we can say the product is promising


Discount 90% Price - Super Bright 240w 480w 720w Samsung Lm301b Lm301h Dimmable Led Board Uv Ir Led Grow Light Meanwell Driver 7 Years Warranty with FREE Worldwide Shipping NOW!



Related Products :


Free Shipping Price ABF 2 in 1 800W Soldering Station 60W Soldering irons 650W Hot Air Gun LED Display Hair Dryer for Soldering Welding Repair Tool with Free Worldwide Shipping Now!

Best Price Jc V1s Dot Matrix Data Read Write For Iphone Face Id Original Color Touch Shock Baseband Logic Battery Fingerprint Programmer with FREE Worldwide Shipping Now!

Best Price 4CH CCTV System 4PCS Ultra 5MP Outdoor Security POE Camera with Hikvision 4 POE NVR DS7604NIK14P DIY Video Surveillance Kits with FREE Worldwide Shipping Now!

Best Offer 50w NJk Rf Coaxial Fixed Attenuator Dc3ghz50 Ohm1db2db3db5db6db10db15db20db30db40db50dbfree Shopping with Free Shipping Worldwide Now!

Special Offer Fashion Handcraft Full Trim Faux Rex Rabbit Fur Cape Coat Loose Knit Cashmere Cloak Shawl Women Fall Winter New Pallium Outwear with Free Worldwide Shipping Now!

Discount 70% Offer ISO Certified MILITECH ATACS AU Deluxe Worm Dial NIJ level IIIA 3A FAST High Cut Ballistic Aramid Helmet With 5 Years Warranty with Free Shipping Worldwide Now!

Popular Offer Caponi Brand Sun Glasses For Driving A Car Sunglasses Polarized Men Square Metal Anti Ray Reflection Shades For Male Uv400 Cp031 with Free Shipping Worldwide Now!

Best Offer Hiseeu16CH 5in1 AHD DVR for CVBS TVI AHD Analog IP Camera CCTV NVR P2P Cloud H264 VGA HDMI Security System Video Recorder Audio with FREE Worldwide Shipping Now!

Cheap Offer Modern Sputnik Ceiling Lights Fixture Nordic Semi Flush Mount Ceiling Lamps Brushed Antique Gold Lighting 6Light Home Decor with Free Shipping Worldwide Now!

Limited Price 10 Inch WIFI Digital picture frame Screen with 1920x1080 IPS Screen Digital Photo Frame Share Photos via App Email 16GB Storage with FREE Worldwide Shipping Now!


Discount Offer Luxury Post Modern Golden And Black Ceremic Table Lamps Bedside Lamp For Bedroom Living Room European Home Decoration with FREE Shipping Worldwide Now!

US $84.00 Luxury Post Modern Golden And Black Ceremic Table Lamps Bedside Lamp For Bedroom Living Room European Home Decoration
US $84.00 Original Price : US $US $168.00 (-50%)  

Cheap Offer Luxury Post Modern Golden And Black Ceremic Table Lamps Bedside Lamp For Bedroom Living Room European Home Decoration with FREE Shipping Worldwide!

US $84.00 Luxury Post Modern Golden And Black Ceremic Table Lamps Bedside Lamp For Bedroom Living Room European Home Decoration
US $84.00 Luxury Post Modern Golden And Black Ceremic Table Lamps Bedside Lamp For Bedroom Living Room European Home Decoration
 5


Related Products :


Free Shipping Offer Pure Silver Sterling 925 Silver Retro Creative Ballpoint Pen S925 Jewelry FGL with FREE Worldwide Shipping Now!

Discount 70% Price Pearl Wedding Veil Crystal Bridal Veil Beaded Veil Ivory White Elbow Veil with FREE Shipping Worldwide Now!

Free Shipping Offer Gas Cutting Torch Welding Torch Kit Usa 6290 Tips Welding Goggle Spark Lighter Tip Cleaner Twin Hose Metal Cutting Welding Tool with Free Worldwide Shipping Now!

Limited Price Merrys 156 161 167 Progressive Multifocal Lenses Bifocal Prescription Myopia Hyperopia Resistance Short Middle Far Lens with Free Worldwide Shipping Now!

Discount 80% Offer 2021 auto repair software all data mill 2015 alldata 1053 vivid workshop 102 atsg moto heavy truck 49 in 1TB HDD USB30 with FREE Shipping Worldwide Now!

Popular Offer Hiseeu Wireless 4K IP Camera WIFI Outdoor ONVIF Waterproof 8MP 5MP 4MP 2MP SD Card App Alarm CCTV Security Camera Remote View with FREE Worldwide Shipping Now!

Discount 70% Offer Laoa 8 Inch Crimping Tools NeedleNose Pliers Multitool Nippers Cable Wire Stripper Aalicate Long Nose Pliers With Lock Function with FREE Shipping Worldwide Now!

Best Offer C20 C25 32 Mta2 Mtb3 Mt4 Bidirectional Floating Tool Holder Wire Tapping Tool Holder Morse Telescopic Arbor with Free Worldwide Shipping Now!

Special Offer Escape Room Game Prop Colorful Buttons Props Light up the Buttons in Correct Sequence to Unlock Adventure Game Props with FREE Shipping Worldwide Now!

Limited Price High Quality Mini Straight Pneumatic Hammer Alloy Steel Hardened Massage Hammer Shoe Edge Shaping Hammer Shoe Beater with Free Shipping Worldwide Now!

Cheap Offer Luxury Post Modern Golden And Black Ceremic Table Lamps Bedside Lamp For Bedroom Living Room European Home Decoration with FREE Shipping Worldwide!


Brand Name: SeeingDays
Is Bulbs Included: Yes
Origin: CN(Origin)
Application: Bed Room
Body Color: Black
Certification: CCC
Shade Direction: Down
Base Type: E27
Is Dimmable: No
Body Material: Ceramic
Plug Type: EU Plug
Voltage: 110V
Voltage: 220V
Voltage: 90-260V
Switch Type: Knob switch
Light Source: LED Bulbs
Style: Modern
Finish: Polished Chrome
Power Source: AC
Technics: Plated
Frame Color: Silver
Shade Type: Fabric
Wattage: 16-20W
Material: Ceramic
Warranty: 5 Years


At this time of writing, the Original Luxury Post Modern Golden And Black Ceremic Table Lamps Bedside Lamp For Bedroom Living Room European Home Decoration has garnered 2 customer reviews with rating of 5 out of 5 stars. Not a bad score at all as if you round it off, it’s actually a perfect five already. From the looks of that rating, we can say the product is promising


Cheap Offer - Luxury Post Modern Golden And Black Ceremic Table Lamps Bedside Lamp For Bedroom Living Room European Home Decoration with FREE Shipping Worldwide NOW!



Related Products :


Cheap Price 200pairs Authentic 3M 3121250 Foam Soft corded Ear Plugs Noise Reduction Norope Earplugs Swimming Protective earmuffs with FREE Worldwide Shipping Now!

Discount 80% Price 2020 SHIMANO SARAGOSA 5000XG 6000HG 8000HG 10000PG 14000XG 18000HG 20000PG Metal Body Spool Saltwater Spinning Fishing Reel with Free Shipping Worldwide Now!

Special Offer G45 Globe E14 Led Lamp Silver Mirror 4w Retro Led Filament Light Bulb E12 110v E27 Warm White 2700k Decorative Light Dimmable with Free Worldwide Shipping Now!

Limited Price Misecu H265 16ch 5mp Poe Nvr Kit Security Ip Bullet Camera Audio Outdoor Waterproof Face Detection P2p Video Surveillance Set with Free Shipping Worldwide Now!

Discount Offer Led Pendant Lamp Dimmable Hanging Lights Kitchen Island Dining Room Shop Bar Counter Decoration Cylinder Pipe Kitchen Lights with FREE Worldwide Shipping Now!

Discount 80% Offer PowMr MPPT 60A Solar Charge Controller SCF60A48V36V24V12V For Max 150V Input Dual Fan Cooling BackLight LCD Solar Regulator with Free Worldwide Shipping Now!

Cheap Offer Reven Jate Titanium Men Glasses Frame Rimless Eyeglasses Optical Prescription Man Eyewear Spectacles For Male Vision Correction with FREE Worldwide Shipping Now!

Popular Offer 2020 Desert Rat 500 Soft Vision Stone Kanye West Sneakers Running Shoes Bone White Utility Black Salt 3M Men Women Trainer with FREE Worldwide Shipping Now!

Limited Price Electric Trimmer Lithium Battery Garden Power Tools Portable Cordless Grass Trimmer Lawn Cutter Mower Grass Cutting Machine with FREE Shipping Worldwide Now!

Discount Price Dahua Imou Smart Alarm System with Alarm Station Motion Detector Door Contact Siren Remotel Control Smart Home Security Solution with FREE Shipping Worldwide Now!